(data stored in ACNUC7421 zone)

EMBL: CP000478.PE444

CP000478.PE444       Location/Qualifiers
FT   CDS             539971..540933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0448"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase, E1 component; KEGG: tte:TTE0186
FT                   Thiamine pyrophosphate-dependent dehydrogenases, E1
FT                   component alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16148"
FT                   /db_xref="GOA:A0LFE6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE6"
FT                   /protein_id="ABK16148.1"
FT                   /translation="MPPTKEKLLEMLRSMLLTRRFEEKLTELCQIEGKVPGMMILCTGQ
FT                   EAVAAGVCAALEPQDVIVPNHRSHGHLLARGADPNALMAECFGKRTGFNKGKSGTLHVA
FT                   VPEVNALCTTTVVGGGIPIAAGVAFAQKYRKQKNVTVCFFGDGAADEGSFHEALNLAAL
FT                   WDLPVLFVCENNLYAGAQRYEEHTKIRDMADRAVAYGIPGIVVDGNDARVVYAAAERAR
FT                   ARAVAGEGPSLIECKTYRCRGHGESDHQLYQPPEEIASWKERCPLPRLRDEVLAQELLD
FT                   EKALKSMEDEISRIVEDAVRFAEESPWPDPEDALSDVYV"
     MPPTKEKLLE MLRSMLLTRR FEEKLTELCQ IEGKVPGMMI LCTGQEAVAA GVCAALEPQD        60
     VIVPNHRSHG HLLARGADPN ALMAECFGKR TGFNKGKSGT LHVAVPEVNA LCTTTVVGGG       120
     IPIAAGVAFA QKYRKQKNVT VCFFGDGAAD EGSFHEALNL AALWDLPVLF VCENNLYAGA       180
     QRYEEHTKIR DMADRAVAYG IPGIVVDGND ARVVYAAAER ARARAVAGEG PSLIECKTYR       240
     CRGHGESDHQ LYQPPEEIAS WKERCPLPRL RDEVLAQELL DEKALKSMED EISRIVEDAV       300
     RFAEESPWPD PEDALSDVYV                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page