(data stored in ACNUC7421 zone)

EMBL: CP000478.PE445

CP000478.PE445       Location/Qualifiers
FT   CDS             540969..541946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0449"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein; KEGG: bha:BH0777 acetoin dehydrogenase
FT                   (TPP-dependent) beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16149"
FT                   /db_xref="GOA:A0LFE7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE7"
FT                   /protein_id="ABK16149.1"
FT                   /translation="MQQLTMGQAVNQALREEMLRDPNVFIAGEGVGVSIHAAPVLPTFG
FT                   LLEEFGPDRVKDTPVSEAAIAGLAVGASVMGLRPVVEIMFNPFVTLASDMIVNHAAKLR
FT                   YLSGGKSTFPMVVRIKSGAGFKAGCQHSHNLEAWLAHCPGIRVVMPSTPADAKGLLKSA
FT                   IRDDNPVVFIEDMLLYFVPGPVPEEEYLVPIGKADVKRQGSDVTIVTWSKMLGAAMKGA
FT                   ALLEQKGVSAEVIDLRTLAPLDKDAILDSVRKTGRLVVLHEATRTGGFAGEICALVAEE
FT                   ALGSLKAPFRRVTGPDIPVPFSPPLEAFYIPDEHDLVKAVESIV"
     MQQLTMGQAV NQALREEMLR DPNVFIAGEG VGVSIHAAPV LPTFGLLEEF GPDRVKDTPV        60
     SEAAIAGLAV GASVMGLRPV VEIMFNPFVT LASDMIVNHA AKLRYLSGGK STFPMVVRIK       120
     SGAGFKAGCQ HSHNLEAWLA HCPGIRVVMP STPADAKGLL KSAIRDDNPV VFIEDMLLYF       180
     VPGPVPEEEY LVPIGKADVK RQGSDVTIVT WSKMLGAAMK GAALLEQKGV SAEVIDLRTL       240
     APLDKDAILD SVRKTGRLVV LHEATRTGGF AGEICALVAE EALGSLKAPF RRVTGPDIPV       300
     PFSPPLEAFY IPDEHDLVKA VESIV                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page