(data stored in ACNUC7421 zone)

EMBL: CP000478.PE448

CP000478.PE448       Location/Qualifiers
FT   CDS             546877..547611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0452"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: dvu:DVU2209
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16152"
FT                   /db_xref="GOA:A0LFF0"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF0"
FT                   /protein_id="ABK16152.1"
FT                   /translation="MDELDTLMDLIRQKYEVEVVPLKIGDRTLRLLQLTDFEAYIERLV
FT                   DSGGVGIMDLPFWAKVWDSSFLLAWFLGKQPVVPGRRLLEIGAGMGVVGLYAALCGHRV
FT                   TLSDINEDALLFARANARLNGLTEMKILKLDWNDPSPFEPYDIVFGSEVIYDRKSYPLL
FT                   VRFLRRAVAPDGMIFLAKNQGLHAPRFFEELTRYFEFKEKVQEVRSCGEAEKICLYAIR
FT                   RKRSVPEESGVDSAACADGGGT"
     MDELDTLMDL IRQKYEVEVV PLKIGDRTLR LLQLTDFEAY IERLVDSGGV GIMDLPFWAK        60
     VWDSSFLLAW FLGKQPVVPG RRLLEIGAGM GVVGLYAALC GHRVTLSDIN EDALLFARAN       120
     ARLNGLTEMK ILKLDWNDPS PFEPYDIVFG SEVIYDRKSY PLLVRFLRRA VAPDGMIFLA       180
     KNQGLHAPRF FEELTRYFEF KEKVQEVRSC GEAEKICLYA IRRKRSVPEE SGVDSAACAD       240
     GGGT                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page