(data stored in ACNUC7421 zone)

EMBL: CP000478.PE45

CP000478.PE45        Location/Qualifiers
FT   CDS             61277..62605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP1561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15749"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE97"
FT                   /protein_id="ABK15749.1"
FT                   /translation="MVEKVIIVGAAGRDFHNFNVYFKNNRRYRVVAFTAAQIPNIESRL
FT                   FPPELSGEHYPEGIPIYPEADMARLIREHRIDLVAFSYSDVAHVDVMHRASLAMAEGAD
FT                   FILLGATYTMLKSRKPVIAVCAVRTGSGKSQTTREICRILQNLGKKAVVVRHPMPYGDL
FT                   RSQIVQRFASREDIDVNQCTIEEREEYEPLVDRGIVVYAGIDYARILERAESESEIIIW
FT                   DGGNNDTPFFSPDLHIVVFDPHRPGHELLYYPGETNLIMADVAIINKVDTALPENIESV
FT                   RENIGKFAPRAEIILAESPVTVSDPRRVRGSRVLAVEDGPTLTHGGMPFGAATIAARKY
FT                   GAAEIVDPHPYAVGTIREALLQYPHIGAELPAMGYGERQMRDLEATINAVDCDLVLAST
FT                   PVDLSGLLSMNKPTLRVRYEYKDHGRPGLEEVLTRRLVESGIL"
     MVEKVIIVGA AGRDFHNFNV YFKNNRRYRV VAFTAAQIPN IESRLFPPEL SGEHYPEGIP        60
     IYPEADMARL IREHRIDLVA FSYSDVAHVD VMHRASLAMA EGADFILLGA TYTMLKSRKP       120
     VIAVCAVRTG SGKSQTTREI CRILQNLGKK AVVVRHPMPY GDLRSQIVQR FASREDIDVN       180
     QCTIEEREEY EPLVDRGIVV YAGIDYARIL ERAESESEII IWDGGNNDTP FFSPDLHIVV       240
     FDPHRPGHEL LYYPGETNLI MADVAIINKV DTALPENIES VRENIGKFAP RAEIILAESP       300
     VTVSDPRRVR GSRVLAVEDG PTLTHGGMPF GAATIAARKY GAAEIVDPHP YAVGTIREAL       360
     LQYPHIGAEL PAMGYGERQM RDLEATINAV DCDLVLASTP VDLSGLLSMN KPTLRVRYEY       420
     KDHGRPGLEE VLTRRLVESG IL                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page