(data stored in ACNUC7421 zone)

EMBL: CP000478.PE450

CP000478.PE450       Location/Qualifiers
FT   CDS             548430..549071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfa:Mfla_1749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16154"
FT                   /db_xref="GOA:A0LFF2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF2"
FT                   /protein_id="ABK16154.1"
FT                   /translation="MLTEMVSNFAIRCLETTGYLGAAFLMALESMIAPIPSEAVMPFVG
FT                   FLVADGKWNLWIAVLATSAGSIIGSLASYLMGYHGGKPLVLKVGKYLLLDAHDLERTES
FT                   FFNRRSGTLTIFVSRFVPVVRHLISIPAGTGKMPLGRFLIATLIGATLWNSFLLGCGMV
FT                   LREHWSVVQTYSHQVDIVVVLALLAGAAWFVRARIGARSRKAMASSSEGE"
     MLTEMVSNFA IRCLETTGYL GAAFLMALES MIAPIPSEAV MPFVGFLVAD GKWNLWIAVL        60
     ATSAGSIIGS LASYLMGYHG GKPLVLKVGK YLLLDAHDLE RTESFFNRRS GTLTIFVSRF       120
     VPVVRHLISI PAGTGKMPLG RFLIATLIGA TLWNSFLLGC GMVLREHWSV VQTYSHQVDI       180
     VVVLALLAGA AWFVRARIGA RSRKAMASSS EGE                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page