(data stored in ACNUC7421 zone)

EMBL: CP000478.PE453

CP000478.PE453       Location/Qualifiers
FT   CDS             complement(550963..551364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0457"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   aba:Acid345_1432 methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16157"
FT                   /db_xref="GOA:A0LFF5"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF5"
FT                   /protein_id="ABK16157.1"
FT                   /translation="MASKIKIIVAKPGLDGHDRGAKLLARIFAEAGMEVVYTGLRQTPE
FT                   MIVNAALQEDADVVGLSSLSGVHNYFFPRVVQLMREKGLKDVLIVGGGIIPQEDYEPLK
FT                   KAGVQGVFGPGTPTTEIVKFIQDNVRAKK"
     MASKIKIIVA KPGLDGHDRG AKLLARIFAE AGMEVVYTGL RQTPEMIVNA ALQEDADVVG        60
     LSSLSGVHNY FFPRVVQLMR EKGLKDVLIV GGGIIPQEDY EPLKKAGVQG VFGPGTPTTE       120
     IVKFIQDNVR AKK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page