(data stored in ACNUC7421 zone)

EMBL: CP000478.PE470

CP000478.PE470       Location/Qualifiers
FT   CDS             567833..568327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0474"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: sat:SYN_01264 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16174"
FT                   /db_xref="GOA:A0LFH2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH2"
FT                   /protein_id="ABK16174.1"
FT                   /translation="MERRGLEFGVGLFLLIGLACLGYLSFKLGHLNLWGGSDYPVTAKF
FT                   STVAGLKDKAKVFMAGVAIGEVQSIGLKDGEAVVTLSINKDVKLEDDVIASIKTSGLIG
FT                   DKYVSVTAGASDQYIKPGGAIRDTQPPLDIENLLGRFVFGSVEQPKGQGGEGKQDDGAL
FT                   R"
     MERRGLEFGV GLFLLIGLAC LGYLSFKLGH LNLWGGSDYP VTAKFSTVAG LKDKAKVFMA        60
     GVAIGEVQSI GLKDGEAVVT LSINKDVKLE DDVIASIKTS GLIGDKYVSV TAGASDQYIK       120
     PGGAIRDTQP PLDIENLLGR FVFGSVEQPK GQGGEGKQDD GALR                        164
//

If you have problems or comments...

PBIL Back to PBIL home page