(data stored in ACNUC7421 zone)

EMBL: CP000478.PE474

CP000478.PE474       Location/Qualifiers
FT   CDS             complement(571023..573344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0478"
FT                   /product="cysteine synthases"
FT                   /note="TIGRFAM: cysteine synthases; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   cysteinyl-tRNA synthetase, class Ia; KEGG: sat:SYN_00075
FT                   cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16178"
FT                   /db_xref="GOA:A0LFH6"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH6"
FT                   /protein_id="ABK16178.1"
FT                   /translation="MKTVFSNVLESIGNTPLIRINRLNPNPAVTLYAKLEAKNPGGSIK
FT                   DRTALFMIESAERDGLLTHEKIIIEATSGNTGIGLAIVAAVKGYRLMLAMPETASLERQ
FT                   KILKALGAEILLTPGNLGTDGAIEKVYSLVRENPDRYYMPDQFNNPANPAAHHFGTGPE
FT                   IFEQTEGKVNTVVVTLGTTGTAMGILQAMKERDPAIRVVGVEPYPGHRVQGLKNMKESY
FT                   VPGIFDRHALDQIIHIKDEDAFEMARRLAREEGIFTGMSSGAAMAIAVRVAEEMREGIV
FT                   VAVLPDGGDRYLSTNLFTTLLEPDFHFFNFLERKKVDFKPVVEGKVRICVTGPPLDNPL
FT                   TLGESRRFLLADFLARFLTAKSFSVEQVVQVPDLDSRTIGGSLASRMPLSAYTRQQLDL
FT                   ILEDLDRLAVKRAYRYPRSSEHINAITEDTKTLVNKGLAYDKLRSVYFNLSGSKDYGAL
FT                   SRVNLKKIRIGTTVDLDAYEKLNPRDFALLKRATLAELKRGVCLKTDWGNVIPTWHIAA
FT                   ASVALRELGAPIDIQVSSVDFLFPHLENVREIGHALTGKPFANVWMLSERMWSGADVKR
FT                   EDGLSEETPIRELNKLGYSPIEVRYWLLSNHYRKPIHVTPENIDNARRGYHRLREFIHR
FT                   VQHARTASQDHKLLPEMIYALEQGFFDALADDLNVPRAFACLFRFIRQFNPILDREEFS
FT                   EAQRRQITDVFYKINGIMGIFDLELQPLSEDDQELIHRREKARGSGEWDTADRIRETLL
FT                   QRGLKVIDTPLGTRWERVEH"
     MKTVFSNVLE SIGNTPLIRI NRLNPNPAVT LYAKLEAKNP GGSIKDRTAL FMIESAERDG        60
     LLTHEKIIIE ATSGNTGIGL AIVAAVKGYR LMLAMPETAS LERQKILKAL GAEILLTPGN       120
     LGTDGAIEKV YSLVRENPDR YYMPDQFNNP ANPAAHHFGT GPEIFEQTEG KVNTVVVTLG       180
     TTGTAMGILQ AMKERDPAIR VVGVEPYPGH RVQGLKNMKE SYVPGIFDRH ALDQIIHIKD       240
     EDAFEMARRL AREEGIFTGM SSGAAMAIAV RVAEEMREGI VVAVLPDGGD RYLSTNLFTT       300
     LLEPDFHFFN FLERKKVDFK PVVEGKVRIC VTGPPLDNPL TLGESRRFLL ADFLARFLTA       360
     KSFSVEQVVQ VPDLDSRTIG GSLASRMPLS AYTRQQLDLI LEDLDRLAVK RAYRYPRSSE       420
     HINAITEDTK TLVNKGLAYD KLRSVYFNLS GSKDYGALSR VNLKKIRIGT TVDLDAYEKL       480
     NPRDFALLKR ATLAELKRGV CLKTDWGNVI PTWHIAAASV ALRELGAPID IQVSSVDFLF       540
     PHLENVREIG HALTGKPFAN VWMLSERMWS GADVKREDGL SEETPIRELN KLGYSPIEVR       600
     YWLLSNHYRK PIHVTPENID NARRGYHRLR EFIHRVQHAR TASQDHKLLP EMIYALEQGF       660
     FDALADDLNV PRAFACLFRF IRQFNPILDR EEFSEAQRRQ ITDVFYKING IMGIFDLELQ       720
     PLSEDDQELI HRREKARGSG EWDTADRIRE TLLQRGLKVI DTPLGTRWER VEH              773
//

If you have problems or comments...

PBIL Back to PBIL home page