(data stored in ACNUC7421 zone)

EMBL: CP000478.PE475

CP000478.PE475       Location/Qualifiers
FT   CDS             573770..576496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0479"
FT                   /product="ATP-dependent nuclease subunit B-like"
FT                   /note="KEGG: pca:Pcar_1709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16179"
FT                   /db_xref="GOA:A0LFH7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH7"
FT                   /protein_id="ABK16179.1"
FT                   /translation="MTNLEYQEKLLDLITDGHTVLSETERFANQLRLRARGRYRRQGAP
FT                   GWDGVAVGTFNAWAMDCWEDSWPNEWPASDFTRWRLIREILRHNPPPEPLLPDLPLVVA
FT                   VDESFAGCLRYGIDPGEGDPANRLVEWRRGVWKEYRDALRALLLFHPASLPERLGSFLS
FT                   LNPDAVPSKTVIAGFEFAGYWEKKLFSRLADTHGALALPLPQVKAKPRAVVYADREQEV
FT                   FGLLGDLIRGAGEGRLHELAVVLLDRGTYAPILSQHLKDLLGAQLEGENAAYNLLAGDV
FT                   LTSQSLWRAALLPLDFCLGGESGTQLFSLLRSPYYGYFGARGRALAQWDRVWREQGIEK
FT                   GLTALLGSLGGREDVLPRRGAELTEGLGALTDRGTRAASEWSAGLRSFWKQMEFPVIAN
FT                   ERDRIAWQRLTGLLDGFDAELGDSSMRAAEFAAWLTAAGEKAPVQPSGFEDAGIQVIGE
FT                   LELRGLAFKRLFVPGFLSGVIPQPARSLPFLSVRERRLVLGGTAESQFEFAAHLFGQVQ
FT                   AAARETVVSRPLLGEGGEPCLPSPFWPASEETMAPVIPWRHDLPVMQRARWVRDGIEGI
FT                   AAAMERKEPAGKTHAGGESAPDLYRAERLRFPSEVSVSELELLLACAGRFFLRVILGLE
FT                   ALPVPTRGLDAAVRGRKIHALLAGFGRRLRGIPGGHEREPEALCRLLDEMVRKDIEEQA
FT                   RVAHWRVELARLLGGAEGAPGLLKEWLALECSRFGEGWRWTAFEPSFDNLKLRDCPVGI
FT                   KGRLDRLDLHSELGCICWDYKTGAAPGMKEVLEDFKAPQLPVYLLAVRKGLVPAIGDRR
FT                   VTLAAGYIALQSVRKLNHCLVIGADERMESFLSQWESVLAEKIDAARRGQLAPLWVLQP
FT                   CEERCDYECLCGELLFAGPEAASGCAAPGNPVERGRG"
     MTNLEYQEKL LDLITDGHTV LSETERFANQ LRLRARGRYR RQGAPGWDGV AVGTFNAWAM        60
     DCWEDSWPNE WPASDFTRWR LIREILRHNP PPEPLLPDLP LVVAVDESFA GCLRYGIDPG       120
     EGDPANRLVE WRRGVWKEYR DALRALLLFH PASLPERLGS FLSLNPDAVP SKTVIAGFEF       180
     AGYWEKKLFS RLADTHGALA LPLPQVKAKP RAVVYADREQ EVFGLLGDLI RGAGEGRLHE       240
     LAVVLLDRGT YAPILSQHLK DLLGAQLEGE NAAYNLLAGD VLTSQSLWRA ALLPLDFCLG       300
     GESGTQLFSL LRSPYYGYFG ARGRALAQWD RVWREQGIEK GLTALLGSLG GREDVLPRRG       360
     AELTEGLGAL TDRGTRAASE WSAGLRSFWK QMEFPVIANE RDRIAWQRLT GLLDGFDAEL       420
     GDSSMRAAEF AAWLTAAGEK APVQPSGFED AGIQVIGELE LRGLAFKRLF VPGFLSGVIP       480
     QPARSLPFLS VRERRLVLGG TAESQFEFAA HLFGQVQAAA RETVVSRPLL GEGGEPCLPS       540
     PFWPASEETM APVIPWRHDL PVMQRARWVR DGIEGIAAAM ERKEPAGKTH AGGESAPDLY       600
     RAERLRFPSE VSVSELELLL ACAGRFFLRV ILGLEALPVP TRGLDAAVRG RKIHALLAGF       660
     GRRLRGIPGG HEREPEALCR LLDEMVRKDI EEQARVAHWR VELARLLGGA EGAPGLLKEW       720
     LALECSRFGE GWRWTAFEPS FDNLKLRDCP VGIKGRLDRL DLHSELGCIC WDYKTGAAPG       780
     MKEVLEDFKA PQLPVYLLAV RKGLVPAIGD RRVTLAAGYI ALQSVRKLNH CLVIGADERM       840
     ESFLSQWESV LAEKIDAARR GQLAPLWVLQ PCEERCDYEC LCGELLFAGP EAASGCAAPG       900
     NPVERGRG                                                                908
//

If you have problems or comments...

PBIL Back to PBIL home page