(data stored in ACNUC7421 zone)

EMBL: CP000478.PE480

CP000478.PE480       Location/Qualifiers
FT   CDS             complement(580709..581347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0484"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: sat:SYN_01683 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16184"
FT                   /db_xref="GOA:A0LFI2"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI2"
FT                   /protein_id="ABK16184.1"
FT                   /translation="MIAILDYRAGNLTSVERALNFLGFPCRITHSHDEIRDADRIIFPG
FT                   VGAAGKSMADLRELGLDELLRERRSSGIPILGICVGMQVLFDHSEENDTVCLGILPGAV
FT                   RRFPNDLTDTKGERLKIPHMGWNSVAFDKAHPVFADVREGNEFYFVHAYFPDPRDSDHI
FT                   VGRTLYGIRFASAVAHDSLVAVQFHPEKSGPPGLRILANFCRWDGRVSR"
     MIAILDYRAG NLTSVERALN FLGFPCRITH SHDEIRDADR IIFPGVGAAG KSMADLRELG        60
     LDELLRERRS SGIPILGICV GMQVLFDHSE ENDTVCLGIL PGAVRRFPND LTDTKGERLK       120
     IPHMGWNSVA FDKAHPVFAD VREGNEFYFV HAYFPDPRDS DHIVGRTLYG IRFASAVAHD       180
     SLVAVQFHPE KSGPPGLRIL ANFCRWDGRV SR                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page