(data stored in ACNUC7421 zone)

EMBL: CP000478.PE481

CP000478.PE481       Location/Qualifiers
FT   CDS             581592..584186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0485"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="2.7.7.59"
FT                   /note="PFAM: amino acid-binding ACT domain protein;
FT                   metal-dependent phosphohydrolase, HD sub domain; GlnD
FT                   PII-uridylyltransferase; KEGG: pca:Pcar_1512 protein-P-II
FT                   uridylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16185"
FT                   /db_xref="GOA:A0LFI3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI3"
FT                   /protein_id="ABK16185.1"
FT                   /translation="MHSISESLRKQREQVLSDSSEDALIRHTSLLEIAIISLYNRLVNR
FT                   LSQDTEHFRSSAAVIGLDGFARGVIGPGQPVRILFLMTDSALWNASWLDEITVPLTEAG
FT                   WTVDLRRETIDSLMIALEGDFEAFLELLEMRYVSGNRQLLEQAEKGIEGFIEARREELL
FT                   SRLYGTVKAREGRLQKPESWLEPDLQDNPGALSDIVAIRLACRIASNIRSLDDAIFMGY
FT                   LVRREVDFIRHAEKSYMRLLGLLRSLSDKSSGVLHFDEQGLLADKLGYAERAGYLPVES
FT                   LMQEVFQLFHGVGVVSAEFWERLRESRENLPAAGEMRGEPLEEGLFVLNGKIHIQTDRY
FT                   PATPGHLVHLFRLAAEGGLGFANVTRQWVHHHRNALNSSSGDPLVKEELFALIRADSED
FT                   LPAFRRFCDNGLFTALIPELAAVYGLAQHDAFHLYPIHEHHLRTLSELKKIRAGFYSAA
FT                   EPELTQIARGIEDPVWLYLAGLLHDIGKSSGRGHAAKGGEMIPAIARRLGLEPEETSKV
FT                   RFLVAQHLLLMDSASLRDLADQEMLAGCAAAVGSSELLDLLVLLSYADMLSTGPKARQK
FT                   WRDTPVLALYNSIRHLLEKGEPSARAITERIERLRNQVRNEVLDLVDEAQLDSYFSQLV
FT                   PRYLLSMQPKAVARHLRMWRHLQSSDTPFVWEVESSGDTAEITIVSWEKPGLLSRCAGL
FT                   LTLHSMNILGAQVFTMHNGLILLIFQCRLPGGAGGGMDWNAVRLDVERLLLGKMALDYR
FT                   IAEHARRRPASQVPMRTAPSQVLVDNQSSAMYTILEVYTVDRVGLLYTIGRTLFELQIR
FT                   ISVAKITTKIDQVADVFYVRTHQGEKVSDPEQIDELKRALLFWLDGPAEMPA"
     MHSISESLRK QREQVLSDSS EDALIRHTSL LEIAIISLYN RLVNRLSQDT EHFRSSAAVI        60
     GLDGFARGVI GPGQPVRILF LMTDSALWNA SWLDEITVPL TEAGWTVDLR RETIDSLMIA       120
     LEGDFEAFLE LLEMRYVSGN RQLLEQAEKG IEGFIEARRE ELLSRLYGTV KAREGRLQKP       180
     ESWLEPDLQD NPGALSDIVA IRLACRIASN IRSLDDAIFM GYLVRREVDF IRHAEKSYMR       240
     LLGLLRSLSD KSSGVLHFDE QGLLADKLGY AERAGYLPVE SLMQEVFQLF HGVGVVSAEF       300
     WERLRESREN LPAAGEMRGE PLEEGLFVLN GKIHIQTDRY PATPGHLVHL FRLAAEGGLG       360
     FANVTRQWVH HHRNALNSSS GDPLVKEELF ALIRADSEDL PAFRRFCDNG LFTALIPELA       420
     AVYGLAQHDA FHLYPIHEHH LRTLSELKKI RAGFYSAAEP ELTQIARGIE DPVWLYLAGL       480
     LHDIGKSSGR GHAAKGGEMI PAIARRLGLE PEETSKVRFL VAQHLLLMDS ASLRDLADQE       540
     MLAGCAAAVG SSELLDLLVL LSYADMLSTG PKARQKWRDT PVLALYNSIR HLLEKGEPSA       600
     RAITERIERL RNQVRNEVLD LVDEAQLDSY FSQLVPRYLL SMQPKAVARH LRMWRHLQSS       660
     DTPFVWEVES SGDTAEITIV SWEKPGLLSR CAGLLTLHSM NILGAQVFTM HNGLILLIFQ       720
     CRLPGGAGGG MDWNAVRLDV ERLLLGKMAL DYRIAEHARR RPASQVPMRT APSQVLVDNQ       780
     SSAMYTILEV YTVDRVGLLY TIGRTLFELQ IRISVAKITT KIDQVADVFY VRTHQGEKVS       840
     DPEQIDELKR ALLFWLDGPA EMPA                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page