(data stored in ACNUC7421 zone)

EMBL: CP000478.PE485

CP000478.PE485       Location/Qualifiers
FT   CDS             587952..588851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0489"
FT                   /product="N-acetylglucosamine kinase"
FT                   /EC_number="2.7.1.59"
FT                   /note="PFAM: ROK family protein; KEGG: mca:MCA0661 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16189"
FT                   /db_xref="GOA:A0LFI7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI7"
FT                   /protein_id="ABK16189.1"
FT                   /translation="MLRLGVDLGGTKIEIIALDDGGNELARFREATPRGDYRSTLEAVA
FT                   RLVSKVEAELGGERGSVGIGTPGAVSRATGLLRNSNSVCLNGKPIARDLEAVLGRPVRI
FT                   ANDANCFALSEYRDGAARGARVVFGAIVGTGTGAGIVVGGEVLEGVNAIAGEWGHNPLP
FT                   WPKDDERPGPRCYCGRYGCIETFLSGPGMAALHALSTGDRLPPEEIVARADEGDPSCEH
FT                   TLLRYEDRMARSLAHVINILDPDVIVLGGGMSNIRRLYRNVPRLWGAYVFSDRVDTRLV
FT                   PPRFGDSSGVRGAAWLWG"
     MLRLGVDLGG TKIEIIALDD GGNELARFRE ATPRGDYRST LEAVARLVSK VEAELGGERG        60
     SVGIGTPGAV SRATGLLRNS NSVCLNGKPI ARDLEAVLGR PVRIANDANC FALSEYRDGA       120
     ARGARVVFGA IVGTGTGAGI VVGGEVLEGV NAIAGEWGHN PLPWPKDDER PGPRCYCGRY       180
     GCIETFLSGP GMAALHALST GDRLPPEEIV ARADEGDPSC EHTLLRYEDR MARSLAHVIN       240
     ILDPDVIVLG GGMSNIRRLY RNVPRLWGAY VFSDRVDTRL VPPRFGDSSG VRGAAWLWG        299
//

If you have problems or comments...

PBIL Back to PBIL home page