(data stored in ACNUC7421 zone)

EMBL: CP000478.PE486

CP000478.PE486       Location/Qualifiers
FT   CDS             588908..589438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0490"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix domain protein; bacteriophage
FT                   CI repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16190"
FT                   /db_xref="GOA:A0LFI8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI8"
FT                   /protein_id="ABK16190.1"
FT                   /translation="MSGLRDFRRKGIGCGSVSFDPRGAHPSVHICLSGRNESCIFSHFC
FT                   NDRPAVTPSEGTYQENDVKAYGWFKEMRDEARDSFEFKLAALKIEVTERILEAMERRSM
FT                   NRKQLADSLGVSKASVSRLLNNGSNATLKTLLQIAEALDCDLSIGIRRRAAARDSGKTE
FT                   EEDPEKMKKAAAR"
     MSGLRDFRRK GIGCGSVSFD PRGAHPSVHI CLSGRNESCI FSHFCNDRPA VTPSEGTYQE        60
     NDVKAYGWFK EMRDEARDSF EFKLAALKIE VTERILEAME RRSMNRKQLA DSLGVSKASV       120
     SRLLNNGSNA TLKTLLQIAE ALDCDLSIGI RRRAAARDSG KTEEEDPEKM KKAAAR           176
//

If you have problems or comments...

PBIL Back to PBIL home page