(data stored in ACNUC7421 zone)

EMBL: CP000478.PE487

CP000478.PE487       Location/Qualifiers
FT   CDS             589779..590630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0491"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: pca:Pcar_0453 periplasmic protein TonB
FT                   links inner and outer membranes-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16191"
FT                   /db_xref="GOA:A0LFI9"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI9"
FT                   /protein_id="ABK16191.1"
FT                   /translation="MRLWQNLTISILGHLGVACVLWATPLAIYRPPPWMEVRLISPADF
FT                   HGRAEIPCDGNGAGEGGPAADDNIHAAPKEVCAVKQLPPPEQRPEEPKLEPPVRNRSVK
FT                   KEKPPAKPKGASRVVPLAAIRADAQRPADPAESSAGEGAAAAGSHASIGPGTFASGTPS
FT                   GGSVDAGAGAGSLSPGGPGEGVVDARFGAANGPRFHRLVKPRYPSVARQLGKEGTVVLR
FT                   VTIDEKGRAIHVEVLTRAGSGFEEEAILAVRESTFTPARLNGHAVKSRAVLPIRFALTN
FT                   SG"
     MRLWQNLTIS ILGHLGVACV LWATPLAIYR PPPWMEVRLI SPADFHGRAE IPCDGNGAGE        60
     GGPAADDNIH AAPKEVCAVK QLPPPEQRPE EPKLEPPVRN RSVKKEKPPA KPKGASRVVP       120
     LAAIRADAQR PADPAESSAG EGAAAAGSHA SIGPGTFASG TPSGGSVDAG AGAGSLSPGG       180
     PGEGVVDARF GAANGPRFHR LVKPRYPSVA RQLGKEGTVV LRVTIDEKGR AIHVEVLTRA       240
     GSGFEEEAIL AVRESTFTPA RLNGHAVKSR AVLPIRFALT NSG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page