(data stored in ACNUC7421 zone)

EMBL: CP000478.PE490

CP000478.PE490       Location/Qualifiers
FT   CDS             594872..595882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0494"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: mac:MA4605 iron(III) ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16194"
FT                   /db_xref="GOA:A0LFJ2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ2"
FT                   /protein_id="ABK16194.1"
FT                   /translation="MGFVNRKWLKFSLGISPLLFGGLSLFWGAYGISPLLTAKILLSKV
FT                   FFFDATPAPELSIVWEIRLPRVVLSGVVGAALSGAGVTLQGIFRNPLVDPFILGLSSGA
FT                   AFGCALSVAVFPQFPIQVAAFLFSLVASFSTYMLARTQGEVSRLHLVLSGIVVSAFFSA
FT                   LVSILKFLVDPHKLVSIVYWLLGSFSLADWRAVGVVSLSMLAVSFPLILMRWRLNALSM
FT                   GEDEARALGIPVERDRLLFIGAASLAVGSAVSVSGIIGWVGLMVPHLTRMLVGPDHRVL
FT                   VPFSLAVGAAFMIFADTLARNLTAFDLPVGIITTLSGTPFFVYLMKRGAKESWGK"
     MGFVNRKWLK FSLGISPLLF GGLSLFWGAY GISPLLTAKI LLSKVFFFDA TPAPELSIVW        60
     EIRLPRVVLS GVVGAALSGA GVTLQGIFRN PLVDPFILGL SSGAAFGCAL SVAVFPQFPI       120
     QVAAFLFSLV ASFSTYMLAR TQGEVSRLHL VLSGIVVSAF FSALVSILKF LVDPHKLVSI       180
     VYWLLGSFSL ADWRAVGVVS LSMLAVSFPL ILMRWRLNAL SMGEDEARAL GIPVERDRLL       240
     FIGAASLAVG SAVSVSGIIG WVGLMVPHLT RMLVGPDHRV LVPFSLAVGA AFMIFADTLA       300
     RNLTAFDLPV GIITTLSGTP FFVYLMKRGA KESWGK                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page