(data stored in ACNUC7421 zone)

EMBL: CP000478.PE493

CP000478.PE493       Location/Qualifiers
FT   CDS             600502..601542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0497"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="SMART: AAA ATPase; KEGG: mja:MJ0911
FT                   magnesium-chelatase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16197"
FT                   /db_xref="GOA:A0LFJ5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ5"
FT                   /protein_id="ABK16197.1"
FT                   /translation="MIFPFTAIVGQDQMKLGLILNVIDPTIGGLLIMGEKGTGKSTAVR
FT                   ALADLLPEIAVSRGCAFNCDPDGKNLCTSCVEKASPGRPLESETRKMKVIELPLGITED
FT                   RLVGTLDIEHALKHGAKRFEPGILADANRNFLYVDEVNLLEDHIIDLLLDSAAMGRNFV
FT                   EREGVSFTHPARFILVGTMNPEEGDLRPQLLDRFGLCVYVRSIREREPRMEILRRRFEF
FT                   DADPAAFLEKIEPDQRSLSERIVRARRNLQDIKMPDEILEKVVGVTSAVHVDGHRSDIV
FT                   ILRGARALAALKGRERIEMEDIKDIVRPALNHRLKRAPFEEIGSGASKMEAVIEQLGRS
FT                   DGAAIS"
     MIFPFTAIVG QDQMKLGLIL NVIDPTIGGL LIMGEKGTGK STAVRALADL LPEIAVSRGC        60
     AFNCDPDGKN LCTSCVEKAS PGRPLESETR KMKVIELPLG ITEDRLVGTL DIEHALKHGA       120
     KRFEPGILAD ANRNFLYVDE VNLLEDHIID LLLDSAAMGR NFVEREGVSF THPARFILVG       180
     TMNPEEGDLR PQLLDRFGLC VYVRSIRERE PRMEILRRRF EFDADPAAFL EKIEPDQRSL       240
     SERIVRARRN LQDIKMPDEI LEKVVGVTSA VHVDGHRSDI VILRGARALA ALKGRERIEM       300
     EDIKDIVRPA LNHRLKRAPF EEIGSGASKM EAVIEQLGRS DGAAIS                      346
//

If you have problems or comments...

PBIL Back to PBIL home page