(data stored in ACNUC7421 zone)

EMBL: CP000478.PE495

CP000478.PE495       Location/Qualifiers
FT   CDS             603884..604267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16199"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ7"
FT                   /protein_id="ABK16199.1"
FT                   /translation="MPTIVQPGIPAPGRNRSVAMARFWAHLKRHNPAMRIKSRQNPALS
FT                   GHKVWRDSREDANRLGKSKDRAHAKSSLTQRRDDGRRSAHTFAKRKGAGDSGACPLPFR
FT                   TCMKTPDKGVTPTSGLQLEIDPA"
     MPTIVQPGIP APGRNRSVAM ARFWAHLKRH NPAMRIKSRQ NPALSGHKVW RDSREDANRL        60
     GKSKDRAHAK SSLTQRRDDG RRSAHTFAKR KGAGDSGACP LPFRTCMKTP DKGVTPTSGL       120
     QLEIDPA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page