(data stored in ACNUC7421 zone)

EMBL: CP000478.PE496

CP000478.PE496       Location/Qualifiers
FT   CDS             complement(604271..605011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0500"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase; KEGG:
FT                   tko:TK1307 nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16200"
FT                   /db_xref="GOA:A0LFJ8"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ8"
FT                   /protein_id="ABK16200.1"
FT                   /translation="MRDDLQQTLVLIKPDALKNSLTGYVLSQFSEFHTGLTFAGTKVVH
FT                   VTRMLAEEHYAEHRGKVFFPALIEMITGHLHYPGEPDKQRVIAIVYKGPDVIRKVREIC
FT                   GPTNPHVARDEKPGCVRSLGTVVALKDAQGNIVGDRMDNLIHASATPEEAEREIKLWFR
FT                   PDDIPPAIRAFPTVHSEACFYYKDGRLFENYEPGTVCVLAPGDVAWESDLNTLKAFAEG
FT                   IPTDSSLQGVVAKYLLNRKVSLSW"
     MRDDLQQTLV LIKPDALKNS LTGYVLSQFS EFHTGLTFAG TKVVHVTRML AEEHYAEHRG        60
     KVFFPALIEM ITGHLHYPGE PDKQRVIAIV YKGPDVIRKV REICGPTNPH VARDEKPGCV       120
     RSLGTVVALK DAQGNIVGDR MDNLIHASAT PEEAEREIKL WFRPDDIPPA IRAFPTVHSE       180
     ACFYYKDGRL FENYEPGTVC VLAPGDVAWE SDLNTLKAFA EGIPTDSSLQ GVVAKYLLNR       240
     KVSLSW                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page