(data stored in ACNUC7421 zone)

EMBL: CP000478.PE499

CP000478.PE499       Location/Qualifiers
FT   CDS             608391..609416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB0188529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16203"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK1"
FT                   /protein_id="ABK16203.1"
FT                   /translation="MKKTLFALVALAVIVVGCGEPALAKGGGKGGGKGAGGAAAPRAAK
FT                   YRPPQPAVSLGSAGFASQYGPVTSYYGSLASQYGSLLSQYGPSIGQTGSSPLQGTSTTG
FT                   TGQGTPIFGQSDVFASTTPGAIPGAPDILSGLSMGLDSGLADLILSGLQGTATAGRPSS
FT                   SRFQLPTAVQILPPTTPGSAAVGQYTYDLSLALAAPQLTSISAFPGQYGTLPLQTGMAA
FT                   LSYGPQAGAYGFVPVTGALGGTAGQYGYFAGQYDMTSSLQDQSTQVALSSAAVTAILDA
FT                   LSSRLRTSSGLPGSTLTGTGIGRFSGSIPGMAAPVGGMPSTLSQFQAAPGMGSPLRMGP
FT                   P"
     MKKTLFALVA LAVIVVGCGE PALAKGGGKG GGKGAGGAAA PRAAKYRPPQ PAVSLGSAGF        60
     ASQYGPVTSY YGSLASQYGS LLSQYGPSIG QTGSSPLQGT STTGTGQGTP IFGQSDVFAS       120
     TTPGAIPGAP DILSGLSMGL DSGLADLILS GLQGTATAGR PSSSRFQLPT AVQILPPTTP       180
     GSAAVGQYTY DLSLALAAPQ LTSISAFPGQ YGTLPLQTGM AALSYGPQAG AYGFVPVTGA       240
     LGGTAGQYGY FAGQYDMTSS LQDQSTQVAL SSAAVTAILD ALSSRLRTSS GLPGSTLTGT       300
     GIGRFSGSIP GMAAPVGGMP STLSQFQAAP GMGSPLRMGP P                           341
//

If you have problems or comments...

PBIL Back to PBIL home page