(data stored in ACNUC7421 zone)

EMBL: CP000478.PE50

CP000478.PE50        Location/Qualifiers
FT   CDS             complement(66965..67630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0051"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: mja:MJ0960 transaldolase-like protein;
FT                   TIGRFAM: putative transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15754"
FT                   /db_xref="GOA:A0LEA2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEA2"
FT                   /protein_id="ABK15754.1"
FT                   /translation="MKFFIDTANLDEIKEAHSLGILDGVTTNPSLIAKEGIANREDFIR
FT                   HIKTICELIQAPVSAEAVSTDAEKMIVEARSLAAIDPHVVVKIPMTIDGLKAVRQLSEE
FT                   GIKTNVTLVFSPLQALMAAKAGATYISPFVGRLDDISADGMNLVEEILEIFSNYLFETE
FT                   IIVASVRNPLHVLAAAKLGADIATIPFKVIDQLAHHPLTDLGVERFLKDWEKVEKQRV"
     MKFFIDTANL DEIKEAHSLG ILDGVTTNPS LIAKEGIANR EDFIRHIKTI CELIQAPVSA        60
     EAVSTDAEKM IVEARSLAAI DPHVVVKIPM TIDGLKAVRQ LSEEGIKTNV TLVFSPLQAL       120
     MAAKAGATYI SPFVGRLDDI SADGMNLVEE ILEIFSNYLF ETEIIVASVR NPLHVLAAAK       180
     LGADIATIPF KVIDQLAHHP LTDLGVERFL KDWEKVEKQR V                           221
//

If you have problems or comments...

PBIL Back to PBIL home page