(data stored in ACNUC7421 zone)

EMBL: CP000478.PE502

CP000478.PE502       Location/Qualifiers
FT   CDS             complement(611847..612143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0506"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase-like"
FT                   /note="KEGG: bur:Bcep18194_B2540 putative
FT                   protein-S-isoprenylcysteine methyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16206"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK4"
FT                   /protein_id="ABK16206.1"
FT                   /translation="MLLFARLSLGRSIGFVPAQRVIVTGGAYRIVRHPIYTGIFLSFIA
FT                   WTLRDYSPRVLAISVIGCGLFVLKSFIEERFLREDPEYRDYLTRVRWRWFPGI"
     MLLFARLSLG RSIGFVPAQR VIVTGGAYRI VRHPIYTGIF LSFIAWTLRD YSPRVLAISV        60
     IGCGLFVLKS FIEERFLRED PEYRDYLTRV RWRWFPGI                                98
//

If you have problems or comments...

PBIL Back to PBIL home page