(data stored in ACNUC7421 zone)

EMBL: CP000478.PE506

CP000478.PE506       Location/Qualifiers
FT   CDS             complement(614941..615771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0510"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mac:MA2730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16210"
FT                   /db_xref="GOA:A0LFK8"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK8"
FT                   /protein_id="ABK16210.1"
FT                   /translation="MMFTNPEVILVEAYVHGYSETEAGRLQDQASTLVELLHPSVSFPA
FT                   GSRILEPGCGVGAQTLYLAGKNPASRITAFDISPDSVRRAREKVARAGLSNVAVEVADI
FT                   FNLPYGAGTFDHLFVCFLLEHLQDPAAALLRLKDMLRENGSVSVIEGDHGSYYCHPRSE
FT                   RADLVVRCLVEVQARKRGNSLIGRELYPLLDRAGFREVQVSPRMVYVDRTRPQLVEGFT
FT                   RKTFIAMIEGVREEALSLELTDEETWDGGIADLYRTTREDGTFCYTFFTAVAFK"
     MMFTNPEVIL VEAYVHGYSE TEAGRLQDQA STLVELLHPS VSFPAGSRIL EPGCGVGAQT        60
     LYLAGKNPAS RITAFDISPD SVRRAREKVA RAGLSNVAVE VADIFNLPYG AGTFDHLFVC       120
     FLLEHLQDPA AALLRLKDML RENGSVSVIE GDHGSYYCHP RSERADLVVR CLVEVQARKR       180
     GNSLIGRELY PLLDRAGFRE VQVSPRMVYV DRTRPQLVEG FTRKTFIAMI EGVREEALSL       240
     ELTDEETWDG GIADLYRTTR EDGTFCYTFF TAVAFK                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page