(data stored in ACNUC7421 zone)

EMBL: CP000478.PE508

CP000478.PE508       Location/Qualifiers
FT   CDS             complement(619093..619623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0512"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE;
FT                   KEGG: ade:Adeh_2630 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16212"
FT                   /db_xref="GOA:A0LFL0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL0"
FT                   /protein_id="ABK16212.1"
FT                   /translation="MNPDQSIHSNGPRPYMNPYLAGLILGAVLLAAFLVLGTGLGASGG
FT                   IARVGAAAQGALMPQHVAGSPYFGAWGSNPLSYYLVFMFAGTLLGGLVSAVAARRVQPQ
FT                   LERGPTASPRRRILMALSGGVLAGFASRLASGCTSGQALTGGAMLATGSLLFLVSLFAA
FT                   GYAAAWFARRQWS"
     MNPDQSIHSN GPRPYMNPYL AGLILGAVLL AAFLVLGTGL GASGGIARVG AAAQGALMPQ        60
     HVAGSPYFGA WGSNPLSYYL VFMFAGTLLG GLVSAVAARR VQPQLERGPT ASPRRRILMA       120
     LSGGVLAGFA SRLASGCTSG QALTGGAMLA TGSLLFLVSL FAAGYAAAWF ARRQWS           176
//

If you have problems or comments...

PBIL Back to PBIL home page