(data stored in ACNUC7421 zone)

EMBL: CP000478.PE509

CP000478.PE509       Location/Qualifiers
FT   CDS             complement(619802..621655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0513"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; KEGG: rha:RHA1_ro08897 possible hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16213"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL1"
FT                   /protein_id="ABK16213.1"
FT                   /translation="MQFNLPVLSHYSYLLISGKEALLVDPDRDITAYLDHAKKHGLTIK
FT                   GVFLTHSHADFVAGHLELVRALNVPVYQNAASGAKYKIEPLKEGSTFKVGAAMVKAVET
FT                   PGHTPDGMCGLVFSEGDDQPKMIFTGDTLFVGSVGRPDLLEGKMTAATLASMSYDTWHN
FT                   VLSKLPDTVAVLPAHGAGSLCGAHLSDDPSSTIGRERSSNPYIRHKGRSEFISAVLEGL
FT                   PEAPQYFKHNAAMNREGPPLVSWDAAPVQAKVDESITRVEDLWLVDLRDPKPYSEGHVP
FT                   GSVNIGLRGRLETWVGTIVPWKAPMVLIGSSAEIKEAVLRLHRVGYTGSVLPFEAWTRA
FT                   GLSLARSGTVKPGELYAQMQDGSAPIIVDVRLPNEWMALRIGTVVNLPLNHLGELSRKL
FT                   DPALPVVAVCNSAYRSSLAVGILQRKGFKQVSSLEGGSAAWIEAGYPVFGSEKQAAGSS
FT                   APRRHVHLAERISPADLNRLLKDLPGTFDLVDIRPPEAFRDYSLPGSTNADPADVLSNA
FT                   GYLTGAGPLIIVDRDGSLAMMIAGILSQKTKRPIKALHGGLDAFWEETELKAAVRAVPL
FT                   PGGGPKFQGPAAPAPAPVPQPATSAPAPSTPGTPKKKSAGC"
     MQFNLPVLSH YSYLLISGKE ALLVDPDRDI TAYLDHAKKH GLTIKGVFLT HSHADFVAGH        60
     LELVRALNVP VYQNAASGAK YKIEPLKEGS TFKVGAAMVK AVETPGHTPD GMCGLVFSEG       120
     DDQPKMIFTG DTLFVGSVGR PDLLEGKMTA ATLASMSYDT WHNVLSKLPD TVAVLPAHGA       180
     GSLCGAHLSD DPSSTIGRER SSNPYIRHKG RSEFISAVLE GLPEAPQYFK HNAAMNREGP       240
     PLVSWDAAPV QAKVDESITR VEDLWLVDLR DPKPYSEGHV PGSVNIGLRG RLETWVGTIV       300
     PWKAPMVLIG SSAEIKEAVL RLHRVGYTGS VLPFEAWTRA GLSLARSGTV KPGELYAQMQ       360
     DGSAPIIVDV RLPNEWMALR IGTVVNLPLN HLGELSRKLD PALPVVAVCN SAYRSSLAVG       420
     ILQRKGFKQV SSLEGGSAAW IEAGYPVFGS EKQAAGSSAP RRHVHLAERI SPADLNRLLK       480
     DLPGTFDLVD IRPPEAFRDY SLPGSTNADP ADVLSNAGYL TGAGPLIIVD RDGSLAMMIA       540
     GILSQKTKRP IKALHGGLDA FWEETELKAA VRAVPLPGGG PKFQGPAAPA PAPVPQPATS       600
     APAPSTPGTP KKKSAGC                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page