(data stored in ACNUC7421 zone)

EMBL: CP000478.PE514

CP000478.PE514       Location/Qualifiers
FT   CDS             627279..629387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV2604 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16218"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL6"
FT                   /protein_id="ABK16218.1"
FT                   /translation="MNSMKRTIAVSVIALAIALGTSWAGAATLEVIDGEYKLPARIHAS
FT                   VASDVKTELWAHVWRPRPRGSYPLVVFLHGNHPTCGRYDSELGVRIDDRVDYTTTGECP
FT                   SGYVVTPNHLGYAYLAGTLASYGYVVVSINANRGVNGAKPETDDYGLNLRRGRLVLRHL
FT                   QELAKWNTEGGAPASLGFQLKGFIDFTQVGLMGHSRGGEGMRAAVAQLNDPDSLWPKRI
FT                   PGLKFRSLFEIGPVDGQTSRTLNPVGVVWNVLLPGCDGDVADLEGMKPFDRMLQDAAEA
FT                   DSLSKSTFQVFGANHNFYNTQWQISDSMGCIGQTAIFPQLKGSASQRRTALRSLVPFFR
FT                   SNLGPAPVEGLARRFDPSFPIPSGLASETSYARGFTRSPRRCENFVIDNFNRRTGLSSR
FT                   NVANESSGLSGYEHGTAGKNQDPTQRAAAIDWRRAGGFFQVNAAAAGEGLDVGNYHALE
FT                   FRVMLRCFDKLCCSPGDPTGDVDFSIAIANADAVLSNPVSLKSVAVVRRPGGSFQGSWV
FT                   NYNELFQTVRIPLSDFTGADLSNFRGVRFTFDRSPKSFIYLANVRLTKARAGNGALASD
FT                   AQTQVGSETVVQTRARDEAQADRNEIVAIRLPGGAAAGVSEKARVPAVEIEVASSRSFP
FT                   VGGALPTLVVGDKTFALSHYPSGATDRLVFTLEAGQFEAIEQGAEVGVRIGGARPWHFG
FT                   LLDKSLAR"
     MNSMKRTIAV SVIALAIALG TSWAGAATLE VIDGEYKLPA RIHASVASDV KTELWAHVWR        60
     PRPRGSYPLV VFLHGNHPTC GRYDSELGVR IDDRVDYTTT GECPSGYVVT PNHLGYAYLA       120
     GTLASYGYVV VSINANRGVN GAKPETDDYG LNLRRGRLVL RHLQELAKWN TEGGAPASLG       180
     FQLKGFIDFT QVGLMGHSRG GEGMRAAVAQ LNDPDSLWPK RIPGLKFRSL FEIGPVDGQT       240
     SRTLNPVGVV WNVLLPGCDG DVADLEGMKP FDRMLQDAAE ADSLSKSTFQ VFGANHNFYN       300
     TQWQISDSMG CIGQTAIFPQ LKGSASQRRT ALRSLVPFFR SNLGPAPVEG LARRFDPSFP       360
     IPSGLASETS YARGFTRSPR RCENFVIDNF NRRTGLSSRN VANESSGLSG YEHGTAGKNQ       420
     DPTQRAAAID WRRAGGFFQV NAAAAGEGLD VGNYHALEFR VMLRCFDKLC CSPGDPTGDV       480
     DFSIAIANAD AVLSNPVSLK SVAVVRRPGG SFQGSWVNYN ELFQTVRIPL SDFTGADLSN       540
     FRGVRFTFDR SPKSFIYLAN VRLTKARAGN GALASDAQTQ VGSETVVQTR ARDEAQADRN       600
     EIVAIRLPGG AAAGVSEKAR VPAVEIEVAS SRSFPVGGAL PTLVVGDKTF ALSHYPSGAT       660
     DRLVFTLEAG QFEAIEQGAE VGVRIGGARP WHFGLLDKSL AR                          702
//

If you have problems or comments...

PBIL Back to PBIL home page