(data stored in ACNUC7421 zone)

EMBL: CP000478.PE516

CP000478.PE516       Location/Qualifiers
FT   CDS             complement(630710..631516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0520"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: noc:Noc_1902
FT                   putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16220"
FT                   /db_xref="GOA:A0LFL8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL8"
FT                   /protein_id="ABK16220.1"
FT                   /translation="MQLDTRFSFFAAAIVSLILLAAPTTSSAASEEKLVDMTFPFSEES
FT                   IYWPTDKPFTPTVVFKGITDGGWWYASNQYAASEHGGTHVDAPIHFHEHGRTIGQVPLQ
FT                   EWIGPAVKIDVTGKSLANRDYQLSVEDLLAWEKKHGPIPQGAWVIMYSGIDDRFYPNRK
FT                   EVLGTDKTGMDAVAELHFPGFSPEAVDFLLANRAITGIAVDTPSIDPGSSKDFKAHRAL
FT                   CKAQKLALENIANLDKIPESGAMLYVIPMFIQNGTGAPARVFAKLP"
     MQLDTRFSFF AAAIVSLILL AAPTTSSAAS EEKLVDMTFP FSEESIYWPT DKPFTPTVVF        60
     KGITDGGWWY ASNQYAASEH GGTHVDAPIH FHEHGRTIGQ VPLQEWIGPA VKIDVTGKSL       120
     ANRDYQLSVE DLLAWEKKHG PIPQGAWVIM YSGIDDRFYP NRKEVLGTDK TGMDAVAELH       180
     FPGFSPEAVD FLLANRAITG IAVDTPSIDP GSSKDFKAHR ALCKAQKLAL ENIANLDKIP       240
     ESGAMLYVIP MFIQNGTGAP ARVFAKLP                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page