(data stored in ACNUC7421 zone)

EMBL: CP000478.PE519

CP000478.PE519       Location/Qualifiers
FT   CDS             633701..634444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd0529 murein transglycosylase D"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16223"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM1"
FT                   /protein_id="ABK16223.1"
FT                   /translation="MQDCSKPRRLVYLVAALFMAAGVIGCATAETSAPAGPPVQAAVQA
FT                   ERTAAPVQVQRPAHQSPGMVAYYPPPGRMDFCGEHVPLENQEVMERFDKEFTLVVYNHA
FT                   QIYRWLKRRDGYFQWMEERLRRLNLPEDLKYVALAESEPPLSTADRKRWAEMRNDFERS
FT                   PESALQYLGDLHRSFRSWSLALAAYCCGEKRIMDESRAQGQSDFYKMMLPQETERYVFK
FT                   VLAIKAVLSDPARYGYELPKGARQR"
     MQDCSKPRRL VYLVAALFMA AGVIGCATAE TSAPAGPPVQ AAVQAERTAA PVQVQRPAHQ        60
     SPGMVAYYPP PGRMDFCGEH VPLENQEVME RFDKEFTLVV YNHAQIYRWL KRRDGYFQWM       120
     EERLRRLNLP EDLKYVALAE SEPPLSTADR KRWAEMRNDF ERSPESALQY LGDLHRSFRS       180
     WSLALAAYCC GEKRIMDESR AQGQSDFYKM MLPQETERYV FKVLAIKAVL SDPARYGYEL       240
     PKGARQR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page