(data stored in ACNUC7421 zone)

EMBL: CP000478.PE521

CP000478.PE521       Location/Qualifiers
FT   CDS             640819..641388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0526"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   lip:LI0173 prophage DLP12 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16225"
FT                   /db_xref="GOA:A0LFM3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM3"
FT                   /protein_id="ABK16225.1"
FT                   /translation="MKWGDVDVERKILTLRAPKGGKTEIIPLSDTTLSAIEDLARKSEY
FT                   VFPGREGAMLTGFKGPWEMVRKEAKLPASFHFHGIRHSFASNLVSSGVDFYTVGGLRTH
FT                   KQAVTTQRYAHLSDEAMRRAVEKSAEVITPKEKKEEAVENDIESAQRAYYGQQKTLLLF
FT                   IENLMADLMRKQFQEKLEKIKKYATI"
     MKWGDVDVER KILTLRAPKG GKTEIIPLSD TTLSAIEDLA RKSEYVFPGR EGAMLTGFKG        60
     PWEMVRKEAK LPASFHFHGI RHSFASNLVS SGVDFYTVGG LRTHKQAVTT QRYAHLSDEA       120
     MRRAVEKSAE VITPKEKKEE AVENDIESAQ RAYYGQQKTL LLFIENLMAD LMRKQFQEKL       180
     EKIKKYATI                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page