(data stored in ACNUC7421 zone)

EMBL: CP000478.PE524

CP000478.PE524       Location/Qualifiers
FT   CDS             643230..643544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16228"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM6"
FT                   /protein_id="ABK16228.1"
FT                   /translation="MRTFRDHLQEKLQDKRFGELFDEEKELVRIGIEVAEARAKLGMSQ
FT                   ADLQMHREIRPPAGSESFLYMPASIKKENGPKTVLEKATASDVPSEVLARFQKSPSKAS
FT                   "
     MRTFRDHLQE KLQDKRFGEL FDEEKELVRI GIEVAEARAK LGMSQADLQM HREIRPPAGS        60
     ESFLYMPASI KKENGPKTVL EKATASDVPS EVLARFQKSP SKAS                        104
//

If you have problems or comments...

PBIL Back to PBIL home page