(data stored in ACNUC7421 zone)

EMBL: CP000478.PE525

CP000478.PE525       Location/Qualifiers
FT   CDS             644554..647721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0530"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   gsu:GSU1842 polysaccharide biosynthesis/export domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16229"
FT                   /db_xref="GOA:A0LFM7"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM7"
FT                   /protein_id="ABK16229.1"
FT                   /translation="MRSKRKMFCATLLSFLLCWNSVCAQQLQQIPSPLAPPFATTSTPV
FT                   SATTGSSPTTTTIPGIPGLPSLTLPQAMMPVPCETLLPGQLPPVGTPPVIPGLPSTAGQ
FT                   VPYLQPCGPGQIPYQPPGVATQVPYQAPGIPSQVPYQPPQGTAAQGPYQPAPGVAGQAL
FT                   VTQPGVGTSQVPYQQPGVPVQGAPVTQPGVAGQVPYQPSAIPGQVPSLQPGVSLQMPVQ
FT                   QPMVPGQPGYPQPTPPTSRGYQAGQVPYQQPAELAVPPILPVEPLSPFEEFVAGKSTST
FT                   PASISFDIKQFGYDLFINSGSPLITGSPISGTAVPGTTGVPGMLGGTSVQTIPGMPGIP
FT                   GTTGHTGPMSTQFGLPILNVPVSPSYVIGPGDEIRIAVWGSVEGTWDVIVDRDGTISLP
FT                   KIGIIGVTNMTFQEVKDTLKNEFSKYYQDFQMNVSMGSLKTIRVYVVGNARNPGAYLVT
FT                   SMSSIVNGLLAAGGPSKAGSMRNIELKRNGDTIAVFDLYELLLKGDKTKDRQLMAEDVL
FT                   YIPPIGSMVGVAGNVERPAIFEMKGKTKLSEAIKMAGGPTADAYLQRIQVERVSQRKAK
FT                   IFLDVDMQGIKGKQDIVLQDGDIVKVFPISMFVTNRIILKGNVRRPGEYEWKHGMRVKD
FT                   IIRNFDALLPDAMLEYALVERLVAPDNHQEYRTFNLREAISGTDRSQNILLEPYDTITV
FT                   YSKWEMQERERVRVSGAVNRPGDFEFRENMKLSDLLKLSGGLKKTAAADNAEITRVVPT
FT                   EAGPRTEQIQVNPTLALAGDPDFDILLHRDDYLTVKSVPDWQLYRKVSIYGEVKYPGDY
FT                   ALQKGERLSSLLERAGGFTDRAYKRGSSLFRESVRQLQQRQMGELIDMLGRQVLANSAA
FT                   NLMGEMTPGEAEFQATQAKQQKLFLDTLRTLQAKGRVVVQLDEPRKLKGTAFDIEVEEG
FT                   DQIYIPINPRVVQVIGAVYNQTAFVYEPGRNYSYYIDQAGGYSPTADKGNVFILKADGS
FT                   AVQPGRGIFWCVATARWQTGANGRLEPGDTVIVPDKLDKVAWMRNFKDLTTVLYQIAVG
FT                   TGVLLRL"
     MRSKRKMFCA TLLSFLLCWN SVCAQQLQQI PSPLAPPFAT TSTPVSATTG SSPTTTTIPG        60
     IPGLPSLTLP QAMMPVPCET LLPGQLPPVG TPPVIPGLPS TAGQVPYLQP CGPGQIPYQP       120
     PGVATQVPYQ APGIPSQVPY QPPQGTAAQG PYQPAPGVAG QALVTQPGVG TSQVPYQQPG       180
     VPVQGAPVTQ PGVAGQVPYQ PSAIPGQVPS LQPGVSLQMP VQQPMVPGQP GYPQPTPPTS       240
     RGYQAGQVPY QQPAELAVPP ILPVEPLSPF EEFVAGKSTS TPASISFDIK QFGYDLFINS       300
     GSPLITGSPI SGTAVPGTTG VPGMLGGTSV QTIPGMPGIP GTTGHTGPMS TQFGLPILNV       360
     PVSPSYVIGP GDEIRIAVWG SVEGTWDVIV DRDGTISLPK IGIIGVTNMT FQEVKDTLKN       420
     EFSKYYQDFQ MNVSMGSLKT IRVYVVGNAR NPGAYLVTSM SSIVNGLLAA GGPSKAGSMR       480
     NIELKRNGDT IAVFDLYELL LKGDKTKDRQ LMAEDVLYIP PIGSMVGVAG NVERPAIFEM       540
     KGKTKLSEAI KMAGGPTADA YLQRIQVERV SQRKAKIFLD VDMQGIKGKQ DIVLQDGDIV       600
     KVFPISMFVT NRIILKGNVR RPGEYEWKHG MRVKDIIRNF DALLPDAMLE YALVERLVAP       660
     DNHQEYRTFN LREAISGTDR SQNILLEPYD TITVYSKWEM QERERVRVSG AVNRPGDFEF       720
     RENMKLSDLL KLSGGLKKTA AADNAEITRV VPTEAGPRTE QIQVNPTLAL AGDPDFDILL       780
     HRDDYLTVKS VPDWQLYRKV SIYGEVKYPG DYALQKGERL SSLLERAGGF TDRAYKRGSS       840
     LFRESVRQLQ QRQMGELIDM LGRQVLANSA ANLMGEMTPG EAEFQATQAK QQKLFLDTLR       900
     TLQAKGRVVV QLDEPRKLKG TAFDIEVEEG DQIYIPINPR VVQVIGAVYN QTAFVYEPGR       960
     NYSYYIDQAG GYSPTADKGN VFILKADGSA VQPGRGIFWC VATARWQTGA NGRLEPGDTV      1020
     IVPDKLDKVA WMRNFKDLTT VLYQIAVGTG VLLRL                                 1055
//

If you have problems or comments...

PBIL Back to PBIL home page