(data stored in ACNUC7421 zone)

EMBL: CP000478.PE527

CP000478.PE527       Location/Qualifiers
FT   CDS             648779..649861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0532"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   dps:DP2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16231"
FT                   /db_xref="GOA:A0LFM9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM9"
FT                   /protein_id="ABK16231.1"
FT                   /translation="MPTIMLPELRPMLHHAAGALRLPLDSADVTPLAGDGSDRRFFRVR
FT                   RGADHYVALISPRKNHQGLDENDSYLKIGEHLHRRGVPVPRIFWADAARGWFLLEDFGD
FT                   RHLQAQVLRGRSSVTAVYRKALEVLVRLHREGRDGFRADYCFDGAFYDPAFVYERELEY
FT                   FRSAFLVSLMRLQIDREDLRSDFERIAEAAGTGSDRFVFHRDFQSRNLMVCKGKLGLVD
FT                   FQGMRFGPPAYDLASLLIDPYVALPARLQEVLCRLYWDDARKFLGGSIDAFLKHYRWVR
FT                   LCRNLQILGAFGYLGTSKGKTRFLAYVPGAWAELTRLLREHFAGCFPRLEECVETVARE
FT                   AAFTFPTGGAQVFRDFAAAN"
     MPTIMLPELR PMLHHAAGAL RLPLDSADVT PLAGDGSDRR FFRVRRGADH YVALISPRKN        60
     HQGLDENDSY LKIGEHLHRR GVPVPRIFWA DAARGWFLLE DFGDRHLQAQ VLRGRSSVTA       120
     VYRKALEVLV RLHREGRDGF RADYCFDGAF YDPAFVYERE LEYFRSAFLV SLMRLQIDRE       180
     DLRSDFERIA EAAGTGSDRF VFHRDFQSRN LMVCKGKLGL VDFQGMRFGP PAYDLASLLI       240
     DPYVALPARL QEVLCRLYWD DARKFLGGSI DAFLKHYRWV RLCRNLQILG AFGYLGTSKG       300
     KTRFLAYVPG AWAELTRLLR EHFAGCFPRL EECVETVARE AAFTFPTGGA QVFRDFAAAN       360
//

If you have problems or comments...

PBIL Back to PBIL home page