(data stored in ACNUC7421 zone)

EMBL: CP000478.PE534

CP000478.PE534       Location/Qualifiers
FT   CDS             657794..658423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0539"
FT                   /product="Pilus assembly protein, PilO"
FT                   /note="PFAM: Pilus assembly protein, PilO; KEGG:
FT                   gsu:GSU2030 type IV pilus biogenesis protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16238"
FT                   /db_xref="GOA:A0LFN6"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN6"
FT                   /protein_id="ABK16238.1"
FT                   /translation="MKKSLIPTGAFTEKLAGLPLAQKALLFLITLAILGAGFYYLVYED
FT                   QEKELAKVTASVAEQQKKLASLKEAAARVDKLQKELAASEADFNSLLALLPDQKEIPGL
FT                   LESVSQLGAKVGLENVLFQPQPEQPKEFYSVIPIRLDLLGSFNDLEVFLDNVSKLNRIL
FT                   KVETLTLNRVKDKGSGSGLQVGCTIVTYRFVDRPVQKDAKKDQKKK"
     MKKSLIPTGA FTEKLAGLPL AQKALLFLIT LAILGAGFYY LVYEDQEKEL AKVTASVAEQ        60
     QKKLASLKEA AARVDKLQKE LAASEADFNS LLALLPDQKE IPGLLESVSQ LGAKVGLENV       120
     LFQPQPEQPK EFYSVIPIRL DLLGSFNDLE VFLDNVSKLN RILKVETLTL NRVKDKGSGS       180
     GLQVGCTIVT YRFVDRPVQK DAKKDQKKK                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page