(data stored in ACNUC7421 zone)

EMBL: CP000478.PE537

CP000478.PE537       Location/Qualifiers
FT   CDS             complement(661376..661807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_01357 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16241"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN9"
FT                   /protein_id="ABK16241.1"
FT                   /translation="MDGKRAPIPEMLLDNGLTLHFEDRSRPIPGGRSQVVLCISIPFRV
FT                   REFVAEDPEITPEQAAQVLGDTVTYSVEKVRNFVPQESVEQNLQQMREEFIRSNLAYLL
FT                   NPSFPRRFLIKKVREALEARRLEEAHSRALHDSAPEHDD"
     MDGKRAPIPE MLLDNGLTLH FEDRSRPIPG GRSQVVLCIS IPFRVREFVA EDPEITPEQA        60
     AQVLGDTVTY SVEKVRNFVP QESVEQNLQQ MREEFIRSNL AYLLNPSFPR RFLIKKVREA       120
     LEARRLEEAH SRALHDSAPE HDD                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page