(data stored in ACNUC7421 zone)

EMBL: CP000478.PE538

CP000478.PE538       Location/Qualifiers
FT   CDS             662072..662665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0543"
FT                   /product="pyruvate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="KEGG: pho:PH0678 pyruvate ferredoxin oxidoreductase,
FT                   gamma subunit; TIGRFAM: pyruvate/ketoisovalerate
FT                   oxidoreductase, gamma subunit; PFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16242"
FT                   /db_xref="GOA:A0LFP0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP0"
FT                   /protein_id="ABK16242.1"
FT                   /translation="MTKKCIEMRWHGRGGQGAVTAAMIMAEAAYYEGYRGVTAAPFFGA
FT                   ERRGAPIIATTRFGREPIRTFSLVEQPDIVVVLDETLLRVVDVSAGVGPEGIVIINSAK
FT                   EPGAIRLKNAVNVATTNATEWAKEAGLIISGAVIFNTAILGGVARATGLISLESIEKAL
FT                   RNHFPGKAGERNVEGARAAYAGTSILQECKLACA"
     MTKKCIEMRW HGRGGQGAVT AAMIMAEAAY YEGYRGVTAA PFFGAERRGA PIIATTRFGR        60
     EPIRTFSLVE QPDIVVVLDE TLLRVVDVSA GVGPEGIVII NSAKEPGAIR LKNAVNVATT       120
     NATEWAKEAG LIISGAVIFN TAILGGVARA TGLISLESIE KALRNHFPGK AGERNVEGAR       180
     AAYAGTSILQ ECKLACA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page