(data stored in ACNUC7421 zone)

EMBL: CP000478.PE539

CP000478.PE539       Location/Qualifiers
FT   CDS             662714..663010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0544"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; KEGG: pho:PH0679
FT                   pyruvate ferredoxin oxidoreductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16243"
FT                   /db_xref="GOA:A0LFP1"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP1"
FT                   /protein_id="ABK16243.1"
FT                   /translation="MNKAREDKFTQARSALCKGEAGRTGDWRSVRPRIDHAKCIPSKNR
FT                   RPSCFICWLYCPEGVVKRSIPVEIDLDYCKGCGICAEECPGKAIEMVEEHEEA"
     MNKAREDKFT QARSALCKGE AGRTGDWRSV RPRIDHAKCI PSKNRRPSCF ICWLYCPEGV        60
     VKRSIPVEID LDYCKGCGIC AEECPGKAIE MVEEHEEA                                98
//

If you have problems or comments...

PBIL Back to PBIL home page