(data stored in ACNUC7421 zone)

EMBL: CP000478.PE540

CP000478.PE540       Location/Qualifiers
FT   CDS             complement(663044..663607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0545"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   sat:SYN_02970 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16244"
FT                   /db_xref="GOA:A0LFP2"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP2"
FT                   /protein_id="ABK16244.1"
FT                   /translation="MTTRRLLLHMCCGPCAIYPLRTLRADGWSVHGFFYNPNIQPCREF
FT                   ERRLEAARTVSEREELPLIVRDDYDPVEFLRNVVFREQQRCVYCYSVRIEAAARIARKS
FT                   GFDAFSTTLLYSKLQKHELIEEIARDTSRRIGVPFIYRDFRQGWREGHEAAKMMGIYRQ
FT                   QYCGCIYSEAERYHRGGKKDRPPK"
     MTTRRLLLHM CCGPCAIYPL RTLRADGWSV HGFFYNPNIQ PCREFERRLE AARTVSEREE        60
     LPLIVRDDYD PVEFLRNVVF REQQRCVYCY SVRIEAAARI ARKSGFDAFS TTLLYSKLQK       120
     HELIEEIARD TSRRIGVPFI YRDFRQGWRE GHEAAKMMGI YRQQYCGCIY SEAERYHRGG       180
     KKDRPPK                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page