(data stored in ACNUC7421 zone)

EMBL: CP000478.PE541

CP000478.PE541       Location/Qualifiers
FT   CDS             complement(663604..665037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0546"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; cytoplasmic peptidoglycan synthetases domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   dps:DP2930 probable
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
FT                   diamino pimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16245"
FT                   /db_xref="GOA:A0LFP3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP3"
FT                   /protein_id="ABK16245.1"
FT                   /translation="MRRKNSKTIYLLGIGGIAMGTLATMLTEKGFNVTGSDLNLYPPMS
FT                   THLETLGIPVCQGYDAANPEKCAPDLVIIGNAIRRTNPEAEYVLSHGLPYLSMPQAIAE
FT                   FFLCAHKSMVVAGTHGKSTTSSLLSWVLSRGGLDPSVFVGAFIKNWNSSYRIGRGPFMV
FT                   IEGDEYDTAFFDKGPKFLHYSPWIGIVTSVEFDHADIFTDFEAVRRAFRSFARLIQPDG
FT                   HLILNADDANCLALAKESRGRVTTYGWSRTADWRIVDMIHTDGRIRFTYENPLSRGTES
FT                   ILTRMPGRHNVSNSMAVMAAASLAGLDRNAVQDGLLTFEGVKRRQDILGEIGGILVMDD
FT                   FAHHPTAVRETIQALKDFYPRRRIFCAFEPRTNSSRRSVFQQAYTTAFDDAFCICIKHP
FT                   PGMDAIPREERLDVQKLVADIAERGKECHGFASAEDLIGFLVDHCASGDLVVCMSNGSF
FT                   DGLPHGLCTALAQKHAGAS"
     MRRKNSKTIY LLGIGGIAMG TLATMLTEKG FNVTGSDLNL YPPMSTHLET LGIPVCQGYD        60
     AANPEKCAPD LVIIGNAIRR TNPEAEYVLS HGLPYLSMPQ AIAEFFLCAH KSMVVAGTHG       120
     KSTTSSLLSW VLSRGGLDPS VFVGAFIKNW NSSYRIGRGP FMVIEGDEYD TAFFDKGPKF       180
     LHYSPWIGIV TSVEFDHADI FTDFEAVRRA FRSFARLIQP DGHLILNADD ANCLALAKES       240
     RGRVTTYGWS RTADWRIVDM IHTDGRIRFT YENPLSRGTE SILTRMPGRH NVSNSMAVMA       300
     AASLAGLDRN AVQDGLLTFE GVKRRQDILG EIGGILVMDD FAHHPTAVRE TIQALKDFYP       360
     RRRIFCAFEP RTNSSRRSVF QQAYTTAFDD AFCICIKHPP GMDAIPREER LDVQKLVADI       420
     AERGKECHGF ASAEDLIGFL VDHCASGDLV VCMSNGSFDG LPHGLCTALA QKHAGAS          477
//

If you have problems or comments...

PBIL Back to PBIL home page