(data stored in ACNUC7421 zone)

EMBL: CP000478.PE546

CP000478.PE546       Location/Qualifiers
FT   CDS             complement(669250..671208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0551"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: gsu:GSU1809 cell division protein FtsH;
FT                   TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16250"
FT                   /db_xref="GOA:A0LFP8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP8"
FT                   /protein_id="ABK16250.1"
FT                   /translation="MSPFYKNLALWLVISLMVILLFNMLQKPQSSSIETTYSQLMASVQ
FT                   KGEVAKVTIQGDRILGTYNDGKLFRTHVPRDPDMIKMLRDHGVDIQAKPEEENPWYVSV
FT                   LVNWFLPMLLLVGMLIFFMRQMQVGGGKAMSFGKSRARLLNENSKKVLFNDVAGIDEAK
FT                   EELQEIVEFLKDPRKFTRLGGRIPKGVLLVGAPGTGKTLLAKAIAGEAGVPFFTISGSD
FT                   FVEMFVGVGASRVRDLFMQGKKNAPCIIFIDEIDAVGRHRGAGLGGGHDEREQTLNQLL
FT                   VEMDGFESNEGVILIAATNRPDVLDPALLRPGRFDRQVVVPVPDIRGREGILHVHLRAK
FT                   PLAPDVDPKVLAKGTPGFSGADLENLVNEAALLAARKNKDLIDMADFESAKDKVMMGLE
FT                   RKSMILTEEEKRNTAYHEAGHALVARLLPGADPLHKVTIIPRGRALGLTQQLPEDDRHT
FT                   YSRDYLLDSIAILMGGRVAEELAFNQRTTGASNDIKRATQLARRMVCEWGMSEDMGPVS
FT                   FGRQEEQVFLGRDIAQHRDFSEQTAIFIDKEVRRIVDENYLRARQMLSDRFTLLEKIAE
FT                   GLLERETLDLRDIDRIILEVDPGLYDEIKRREPPRPPELEIAVDGVGTQEAVAEQPEGG
FT                   TASPDSTSASEQKNQGT"
     MSPFYKNLAL WLVISLMVIL LFNMLQKPQS SSIETTYSQL MASVQKGEVA KVTIQGDRIL        60
     GTYNDGKLFR THVPRDPDMI KMLRDHGVDI QAKPEEENPW YVSVLVNWFL PMLLLVGMLI       120
     FFMRQMQVGG GKAMSFGKSR ARLLNENSKK VLFNDVAGID EAKEELQEIV EFLKDPRKFT       180
     RLGGRIPKGV LLVGAPGTGK TLLAKAIAGE AGVPFFTISG SDFVEMFVGV GASRVRDLFM       240
     QGKKNAPCII FIDEIDAVGR HRGAGLGGGH DEREQTLNQL LVEMDGFESN EGVILIAATN       300
     RPDVLDPALL RPGRFDRQVV VPVPDIRGRE GILHVHLRAK PLAPDVDPKV LAKGTPGFSG       360
     ADLENLVNEA ALLAARKNKD LIDMADFESA KDKVMMGLER KSMILTEEEK RNTAYHEAGH       420
     ALVARLLPGA DPLHKVTIIP RGRALGLTQQ LPEDDRHTYS RDYLLDSIAI LMGGRVAEEL       480
     AFNQRTTGAS NDIKRATQLA RRMVCEWGMS EDMGPVSFGR QEEQVFLGRD IAQHRDFSEQ       540
     TAIFIDKEVR RIVDENYLRA RQMLSDRFTL LEKIAEGLLE RETLDLRDID RIILEVDPGL       600
     YDEIKRREPP RPPELEIAVD GVGTQEAVAE QPEGGTASPD STSASEQKNQ GT               652
//

If you have problems or comments...

PBIL Back to PBIL home page