(data stored in ACNUC7421 zone)

EMBL: CP000478.PE548

CP000478.PE548       Location/Qualifiers
FT   CDS             complement(673208..673657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16252"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ0"
FT                   /protein_id="ABK16252.1"
FT                   /translation="MRSVHAGCNAAKILIIVLAALITASCGMATKEEKQHEQFVAAIDG
FT                   YNAAFRWQDYKTASGFVDPANQEAFWKEADAFLKEVRIMDYEIRNVSFEANGLRGTVFI
FT                   NCRFYLTREPSLQSKMIRQTWQFLEKPKTWQVTNSGYQAILAQTQ"
     MRSVHAGCNA AKILIIVLAA LITASCGMAT KEEKQHEQFV AAIDGYNAAF RWQDYKTASG        60
     FVDPANQEAF WKEADAFLKE VRIMDYEIRN VSFEANGLRG TVFINCRFYL TREPSLQSKM       120
     IRQTWQFLEK PKTWQVTNSG YQAILAQTQ                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page