(data stored in ACNUC7421 zone)

EMBL: CP000478.PE549

CP000478.PE549       Location/Qualifiers
FT   CDS             complement(673761..674336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16253"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ1"
FT                   /protein_id="ABK16253.1"
FT                   /translation="MATASARNGTEERRTPFERLSRRNARPVFFTSSTHAAGVLFMTPP
FT                   APLSRKDRRGPFFSVGSVSAPSGEGAILPPLPAATARFPGCAIPRGRVAPRGVNLRAAH
FT                   ADYEKKEPTGKPAGEKTFVKRPSDARECFESSGFRILRGTNAGNHVQHAPWEDATTVGS
FT                   GSGRSSSLPQKPGESAAAAGAGNDLQLS"
     MATASARNGT EERRTPFERL SRRNARPVFF TSSTHAAGVL FMTPPAPLSR KDRRGPFFSV        60
     GSVSAPSGEG AILPPLPAAT ARFPGCAIPR GRVAPRGVNL RAAHADYEKK EPTGKPAGEK       120
     TFVKRPSDAR ECFESSGFRI LRGTNAGNHV QHAPWEDATT VGSGSGRSSS LPQKPGESAA       180
     AAGAGNDLQL S                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page