(data stored in ACNUC7421 zone)

EMBL: CP000478.PE553

CP000478.PE553       Location/Qualifiers
FT   CDS             677914..679911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0558"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   CHASE2 domain protein; KEGG: sat:SYN_01481 adenylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16257"
FT                   /db_xref="GOA:A0LFQ5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ5"
FT                   /protein_id="ABK16257.1"
FT                   /translation="MSTSRRGNVRATTALVVASFAVVALCFRLLPWVFEPWNSQLVDKL
FT                   FVLRSSVSWLRPVYDPTVVHVDITNSTLHRLDDFYLKRVQFARVVRNLAAMRTAAQAYD
FT                   FIFGTKPDDRDDPALIAAAREAGNAYFGLALALSPQRAARETKVDEEALRTLASTKWVL
FT                   NVEGDVTGFHRGSAPLATFPALAAVSKGLGHISIKIDADGIVRRVPLLVRYEDGFYPSL
FT                   PFRVICDYLGVPPQHIRVVPAEAVVLQQARRPGAPPRDIRIPIDRAGSMIVSFIGPWET
FT                   MKHYNFADVYIASDSRDELEVWRDELEGKIVVVSDVSTGSTDLRPVPTDTEYPLSGMHA
FT                   NAIHTILTEDFFRESTAAEAFLVELSLMACLIVLARSFSSVAFTASAAGMVALCAGGAL
FT                   VSFFSLHAIPQVVRPVLSIGLAVFLVLAYRYINEEKQKEVYRRSFEAYFPPAVVKKIMA
FT                   HPESMAMSAQRKELTVLFSDIASFTTYSSALAPDRIRGFLNEYFDAMVEIVFNHGGTVD
FT                   KYIGDGLMVFFGDPEPQEDHATRCVQAAIDMQRRVRELQNAWRNAGGFPLAVRIGINTG
FT                   EVVVGNMGSRRQFSYTVLGSPVNLAQRLESNAPVGGILISERTRQLIGDGFQTKALGEI
FT                   KVKGIAEPVAVHEVTVSQGEVQDSNSAGNV"
     MSTSRRGNVR ATTALVVASF AVVALCFRLL PWVFEPWNSQ LVDKLFVLRS SVSWLRPVYD        60
     PTVVHVDITN STLHRLDDFY LKRVQFARVV RNLAAMRTAA QAYDFIFGTK PDDRDDPALI       120
     AAAREAGNAY FGLALALSPQ RAARETKVDE EALRTLASTK WVLNVEGDVT GFHRGSAPLA       180
     TFPALAAVSK GLGHISIKID ADGIVRRVPL LVRYEDGFYP SLPFRVICDY LGVPPQHIRV       240
     VPAEAVVLQQ ARRPGAPPRD IRIPIDRAGS MIVSFIGPWE TMKHYNFADV YIASDSRDEL       300
     EVWRDELEGK IVVVSDVSTG STDLRPVPTD TEYPLSGMHA NAIHTILTED FFRESTAAEA       360
     FLVELSLMAC LIVLARSFSS VAFTASAAGM VALCAGGALV SFFSLHAIPQ VVRPVLSIGL       420
     AVFLVLAYRY INEEKQKEVY RRSFEAYFPP AVVKKIMAHP ESMAMSAQRK ELTVLFSDIA       480
     SFTTYSSALA PDRIRGFLNE YFDAMVEIVF NHGGTVDKYI GDGLMVFFGD PEPQEDHATR       540
     CVQAAIDMQR RVRELQNAWR NAGGFPLAVR IGINTGEVVV GNMGSRRQFS YTVLGSPVNL       600
     AQRLESNAPV GGILISERTR QLIGDGFQTK ALGEIKVKGI AEPVAVHEVT VSQGEVQDSN       660
     SAGNV                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page