(data stored in ACNUC7421 zone)

EMBL: CP000478.PE554

CP000478.PE554       Location/Qualifiers
FT   CDS             complement(679995..681566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0559"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: Forkhead-associated protein; adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; GAF domain protein; KEGG:
FT                   mxa:MXAN_3956 putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16258"
FT                   /db_xref="GOA:A0LFQ6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ6"
FT                   /protein_id="ABK16258.1"
FT                   /translation="MARLIIHDTEGVQEIDLVDRNSIGRLSRNRIRIADDLVSKEHCLI
FT                   YLDPRGGYGIKDLGSQNGTFVNGHRIVRETPLSDRDVVTIGRTSCIFLAGDLPHGTSDG
FT                   MEATIQFMDADRSWSQIAQDRFLPEEEIWDEKVLRADYEKLRIAHELQREIGLELNLDR
FT                   IFNRILDRTFQLLNCDRAVILMVGENGGMEVRASKTRHSGEDLVVSSTLVNFVREHKVG
FT                   LICGDALADERFSCAESICNRNIRSSMAVPIVYEQELLGVMIIDSSASVRAYAEKDLLL
FT                   FNNIAHQTSQFTMMAKMAKRIEEEALTRERFQRLMSPDLAEMVVSGSIKVEKGGQNRVA
FT                   TILFADIRGFTSMCENMRAAEVLIMLNEFFELMVDVGFRHEGTVANFIGDMIMLVWGAP
FT                   VFHPDDPVRAVQAAVEMQEVLAEYNRGRREKGLPEIGVGIGINTGDLMAGYLGSTRTMT
FT                   YSVIGDPVNVASRLCALARQNQILISEHSRLSVDNHFETAEISTVKVKGRKAPIRIYEV
FT                   VGRKRN"
     MARLIIHDTE GVQEIDLVDR NSIGRLSRNR IRIADDLVSK EHCLIYLDPR GGYGIKDLGS        60
     QNGTFVNGHR IVRETPLSDR DVVTIGRTSC IFLAGDLPHG TSDGMEATIQ FMDADRSWSQ       120
     IAQDRFLPEE EIWDEKVLRA DYEKLRIAHE LQREIGLELN LDRIFNRILD RTFQLLNCDR       180
     AVILMVGENG GMEVRASKTR HSGEDLVVSS TLVNFVREHK VGLICGDALA DERFSCAESI       240
     CNRNIRSSMA VPIVYEQELL GVMIIDSSAS VRAYAEKDLL LFNNIAHQTS QFTMMAKMAK       300
     RIEEEALTRE RFQRLMSPDL AEMVVSGSIK VEKGGQNRVA TILFADIRGF TSMCENMRAA       360
     EVLIMLNEFF ELMVDVGFRH EGTVANFIGD MIMLVWGAPV FHPDDPVRAV QAAVEMQEVL       420
     AEYNRGRREK GLPEIGVGIG INTGDLMAGY LGSTRTMTYS VIGDPVNVAS RLCALARQNQ       480
     ILISEHSRLS VDNHFETAEI STVKVKGRKA PIRIYEVVGR KRN                         523
//

If you have problems or comments...

PBIL Back to PBIL home page