(data stored in ACNUC7421 zone)

EMBL: CP000478.PE555

CP000478.PE555       Location/Qualifiers
FT   CDS             complement(681773..682558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0560"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   mxa:MXAN_3502 adventurous gliding motility protein AgmI"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16259"
FT                   /db_xref="GOA:A0LFQ7"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ7"
FT                   /protein_id="ABK16259.1"
FT                   /translation="MGTPPKISARNLEQQQAARNQKRFVFSLGPRQIVLCAAGLLLAMC
FT                   WMFIFGILVGRGLPMISSEDVSVRAEFMRFLGLDRPPPSTVEKAAETWQAPEKMLESLK
FT                   YYEELTRKEVFTQAKTAVPPGAPSTSPAAKDAAADTRNKPTKSLPVPLSTPDKPESSDS
FT                   EKTGSGAGGQEPVAANNASEHFTLLVASLKDADNAQKLVEQLRAKGYAPRLHTLDLNGG
FT                   GRWNRVLVGSFRNRESALKFAADFNKKERMEGLVIRESN"
     MGTPPKISAR NLEQQQAARN QKRFVFSLGP RQIVLCAAGL LLAMCWMFIF GILVGRGLPM        60
     ISSEDVSVRA EFMRFLGLDR PPPSTVEKAA ETWQAPEKML ESLKYYEELT RKEVFTQAKT       120
     AVPPGAPSTS PAAKDAAADT RNKPTKSLPV PLSTPDKPES SDSEKTGSGA GGQEPVAANN       180
     ASEHFTLLVA SLKDADNAQK LVEQLRAKGY APRLHTLDLN GGGRWNRVLV GSFRNRESAL       240
     KFAADFNKKE RMEGLVIRES N                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page