(data stored in ACNUC7421 zone)

EMBL: CP000478.PE557

CP000478.PE557       Location/Qualifiers
FT   CDS             complement(684478..685605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0562"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: mta:Moth_2167 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16261"
FT                   /db_xref="GOA:A0LFQ9"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFQ9"
FT                   /protein_id="ABK16261.1"
FT                   /translation="MAHSWVEIDLAALRHNYSRAKERLAPGSRILGVVKSDAYGHGMIP
FT                   VARELVACGASFLAVSKHWEAVDLRAAGIRLPILCLLGVEPSEMAEAIRNEIRPVIYRI
FT                   DHARRLSDTARSLNATATVHVKLDTGMGRLGIPCRHLEAFLNELLTLPAIRLEGVLSHF
FT                   ASADEADKTSSTLQLTRFREAMALLSARGLSVLGHIANSAGLLDLPQAHFDLARPGIML
FT                   YGSPPSLELHKPADLRPVMTFKSKIIQLKDVQAGQPIGYGGTFVTAAPGRIATIPVGYD
FT                   DGYPRLLSNRGRVLVRGMSAPVVGRVSMNMITADVTHIPSAREDDEVVLLGAQGTERVT
FT                   AEEIAQLCGTISYEIYCSIGRNRFKSFHNGIANSN"
     MAHSWVEIDL AALRHNYSRA KERLAPGSRI LGVVKSDAYG HGMIPVAREL VACGASFLAV        60
     SKHWEAVDLR AAGIRLPILC LLGVEPSEMA EAIRNEIRPV IYRIDHARRL SDTARSLNAT       120
     ATVHVKLDTG MGRLGIPCRH LEAFLNELLT LPAIRLEGVL SHFASADEAD KTSSTLQLTR       180
     FREAMALLSA RGLSVLGHIA NSAGLLDLPQ AHFDLARPGI MLYGSPPSLE LHKPADLRPV       240
     MTFKSKIIQL KDVQAGQPIG YGGTFVTAAP GRIATIPVGY DDGYPRLLSN RGRVLVRGMS       300
     APVVGRVSMN MITADVTHIP SAREDDEVVL LGAQGTERVT AEEIAQLCGT ISYEIYCSIG       360
     RNRFKSFHNG IANSN                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page