(data stored in ACNUC7421 zone)

EMBL: CP000478.PE559

CP000478.PE559       Location/Qualifiers
FT   CDS             686315..687388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0564"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   hch:HCH_04470 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16263"
FT                   /db_xref="GOA:A0LFR1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR1"
FT                   /protein_id="ABK16263.1"
FT                   /translation="MADERISYRLREYDYDLPPSLIAQSPLSRREESRLLVLDRGRGAM
FT                   DHVRFRDLPDHLHAEDLLVVNDTRVVPARLIGFKDSGGRIELLVTEPYKSEAEGRRDGY
FT                   WCLAAAAKRTRPGCLISLPDGTVAEVLEAGDGGRIRVRFPDDRPLMTILSEIGAVPLPP
FT                   YINRSGTGDFPGDAEAYQTVYARNPGAVAAPTAGLHFSSALLEAVARAGVEVVRITLHV
FT                   GYGTFAPIRVDDIRDHEMHPEYVRVDEDSTERIRSAIDRKRRIVAVGTTVVRSLEWIAH
FT                   RRGEIMPAAGACAHYIYPGYRFKVVDAMITNFHLPRSSLLLLVSAFAGRRRILEAYREA
FT                   IRREYRFFSYGDAMLIL"
     MADERISYRL REYDYDLPPS LIAQSPLSRR EESRLLVLDR GRGAMDHVRF RDLPDHLHAE        60
     DLLVVNDTRV VPARLIGFKD SGGRIELLVT EPYKSEAEGR RDGYWCLAAA AKRTRPGCLI       120
     SLPDGTVAEV LEAGDGGRIR VRFPDDRPLM TILSEIGAVP LPPYINRSGT GDFPGDAEAY       180
     QTVYARNPGA VAAPTAGLHF SSALLEAVAR AGVEVVRITL HVGYGTFAPI RVDDIRDHEM       240
     HPEYVRVDED STERIRSAID RKRRIVAVGT TVVRSLEWIA HRRGEIMPAA GACAHYIYPG       300
     YRFKVVDAMI TNFHLPRSSL LLLVSAFAGR RRILEAYREA IRREYRFFSY GDAMLIL          357
//

If you have problems or comments...

PBIL Back to PBIL home page