(data stored in ACNUC7421 zone)

EMBL: CP000478.PE563

CP000478.PE563       Location/Qualifiers
FT   CDS             690939..692000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0568"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: gsu:GSU2429 PPIC-type PPIASE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16267"
FT                   /db_xref="GOA:A0LFR5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR5"
FT                   /protein_id="ABK16267.1"
FT                   /translation="MMRKGSRWIPAILASFFVVVFLSPVGAAEKAAKKDAKPTAASNET
FT                   AAKSGASKEPAKGEKVAVVNGTVITRAEYESETKRFERQMAMSGQAPDGAQVAEMKKKV
FT                   LDGLVGREVLKQQAAKLGVKVDPAEVDKEIATLKQRFPNEDEFKKALKNLNLTEESLKA
FT                   QFTQDLGIRKMIDEQVASKITITPEETKKFYDGNPELFKTPEMVRASHVLIKVDPKAGD
FT                   ADKAKAKERITAAQKKVQAGEDFAKVAKEVSECPSAAKGGDLDFFQRGQMVGPFEQAAF
FT                   ALKVGSVSDIVETQFGYHVIKVTDKKEAGVMKYDEIKDRIAQHLKQDRVNQQLAKYIEE
FT                   LKAQAKIEIFPVN"
     MMRKGSRWIP AILASFFVVV FLSPVGAAEK AAKKDAKPTA ASNETAAKSG ASKEPAKGEK        60
     VAVVNGTVIT RAEYESETKR FERQMAMSGQ APDGAQVAEM KKKVLDGLVG REVLKQQAAK       120
     LGVKVDPAEV DKEIATLKQR FPNEDEFKKA LKNLNLTEES LKAQFTQDLG IRKMIDEQVA       180
     SKITITPEET KKFYDGNPEL FKTPEMVRAS HVLIKVDPKA GDADKAKAKE RITAAQKKVQ       240
     AGEDFAKVAK EVSECPSAAK GGDLDFFQRG QMVGPFEQAA FALKVGSVSD IVETQFGYHV       300
     IKVTDKKEAG VMKYDEIKDR IAQHLKQDRV NQQLAKYIEE LKAQAKIEIF PVN              353
//

If you have problems or comments...

PBIL Back to PBIL home page