(data stored in ACNUC7421 zone)

EMBL: CP000478.PE566

CP000478.PE566       Location/Qualifiers
FT   CDS             695908..696186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16270"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR8"
FT                   /protein_id="ABK16270.1"
FT                   /translation="MGPPRSRTPGGRAIAVKRSKAIPGDSERQGIMARFLPLEAAAGGQ
FT                   ARFPADNPAVCAAGLKAPDFPEPSPSPGRPSSAVHGEPESDRIRECE"
     MGPPRSRTPG GRAIAVKRSK AIPGDSERQG IMARFLPLEA AAGGQARFPA DNPAVCAAGL        60
     KAPDFPEPSP SPGRPSSAVH GEPESDRIRE CE                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page