(data stored in ACNUC7421 zone)

EMBL: CP000478.PE568

CP000478.PE568       Location/Qualifiers
FT   CDS             697884..698222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0573"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   ade:Adeh_4248 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16272"
FT                   /db_xref="GOA:A0LFS0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS0"
FT                   /protein_id="ABK16272.1"
FT                   /translation="MKKIEAIVKPFKLDDVKEKLTALGIKGMTVTEVRGFGRQKGHTEI
FT                   YRGAEYVVDFLPKIKIEVAVADVQVVEVVQAIRSAANTGKIGDGKIFVIPLEECIRIRT
FT                   GETGEEAL"
     MKKIEAIVKP FKLDDVKEKL TALGIKGMTV TEVRGFGRQK GHTEIYRGAE YVVDFLPKIK        60
     IEVAVADVQV VEVVQAIRSA ANTGKIGDGK IFVIPLEECI RIRTGETGEE AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page