(data stored in ACNUC7421 zone)

EMBL: CP000478.PE571

CP000478.PE571       Location/Qualifiers
FT   CDS             701361..702773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0576"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: gsu:GSU1835 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase, catalytic region; glutamine synthetase,
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16275"
FT                   /db_xref="GOA:A0LFS3"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS3"
FT                   /protein_id="ABK16275.1"
FT                   /translation="MTPKEVLAYAKQNGAKMVDFKFMDFVGTWQHFTNPIDELGESDFE
FT                   NGYGFDGSSIRGWQPIHASDMLIIPDPTTAKMDPFMAVPTLTMICDVVDPVTKERYTRD
FT                   PRYIAHKAEEYLKFTGIGDAAWFGPEAEFFIFDDIRFDDGCQFGYYHIDSVEGIWNSGR
FT                   VENPNLGYKPRHKEGYFPVPPVDSQQDLRTEMVLKMMEVGIPVECQHHEVATAGQAEID
FT                   MKASTLVKMADNLQWYKYVVKNVARRFGKTVTFMPKPLYGDNGSGMHIHMSIWKEGKPM
FT                   FAGDKYAGLSEMALFAAGGVLKHAAAICAITNPTTNSYKRLVPGYEAPVNLAYSSRNRS
FT                   ASVRIPMYSASPKLKRMEVRFPDPSCNGYLAFSALLMAALDGIENRIDPGEPLDRDIYS
FT                   MTPEELADVPSTPGSLDAALNALESDHEFLLKGDVFTEDVIEKWIEYKRLNEVDPIRMR
FT                   PHPHEFKLYFDV"
     MTPKEVLAYA KQNGAKMVDF KFMDFVGTWQ HFTNPIDELG ESDFENGYGF DGSSIRGWQP        60
     IHASDMLIIP DPTTAKMDPF MAVPTLTMIC DVVDPVTKER YTRDPRYIAH KAEEYLKFTG       120
     IGDAAWFGPE AEFFIFDDIR FDDGCQFGYY HIDSVEGIWN SGRVENPNLG YKPRHKEGYF       180
     PVPPVDSQQD LRTEMVLKMM EVGIPVECQH HEVATAGQAE IDMKASTLVK MADNLQWYKY       240
     VVKNVARRFG KTVTFMPKPL YGDNGSGMHI HMSIWKEGKP MFAGDKYAGL SEMALFAAGG       300
     VLKHAAAICA ITNPTTNSYK RLVPGYEAPV NLAYSSRNRS ASVRIPMYSA SPKLKRMEVR       360
     FPDPSCNGYL AFSALLMAAL DGIENRIDPG EPLDRDIYSM TPEELADVPS TPGSLDAALN       420
     ALESDHEFLL KGDVFTEDVI EKWIEYKRLN EVDPIRMRPH PHEFKLYFDV                  470
//

If you have problems or comments...

PBIL Back to PBIL home page