(data stored in ACNUC7421 zone)

EMBL: CP000478.PE572

CP000478.PE572       Location/Qualifiers
FT   CDS             703428..704192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0577"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01193 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16276"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS4"
FT                   /protein_id="ABK16276.1"
FT                   /translation="MSEDAKPKCIAELSQGQLVRWVIEGLRCTMIHYGYWFREVESRLG
FT                   FERAAEAEATAGDRVLGIVMRRLGAAMGFEVDDRGYPAALTAMSREELLNLIDAVCANW
FT                   LANDGVWFREVEKPFGMVSAKHANDMCWGRFSLYEAFRIKRFLELPKLPGLDGLKTALA
FT                   FRMYSRINKQSIEDVDEHSFIFRMEECRVQMARKRKGLPDYPCKSAGMIEYPYFASAID
FT                   PGIETECIGCPPDRHPEGWFCAWKFMLKPRGR"
     MSEDAKPKCI AELSQGQLVR WVIEGLRCTM IHYGYWFREV ESRLGFERAA EAEATAGDRV        60
     LGIVMRRLGA AMGFEVDDRG YPAALTAMSR EELLNLIDAV CANWLANDGV WFREVEKPFG       120
     MVSAKHANDM CWGRFSLYEA FRIKRFLELP KLPGLDGLKT ALAFRMYSRI NKQSIEDVDE       180
     HSFIFRMEEC RVQMARKRKG LPDYPCKSAG MIEYPYFASA IDPGIETECI GCPPDRHPEG       240
     WFCAWKFMLK PRGR                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page